Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STRAP Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Serine/threonine kinase receptor associated protein

Gene Aliases

U, Unrip, C78091, C79202, AW557906

Gene ID

20901

Swiss Prot

Q9Z1Z2

Accession Number

NP_035629.2

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse STRAP

Target

The SMN complex plays a catalyst role in the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assembly of core snRNPs and their transport to the nucleus. STRAP plays a role in the cellular distribution of the SMN complex. Negatively regulates TGF-beta signaling but positively regulates the PDPK1 kinase activity by enhancing its autophosphorylation and by significantly reducing the association of PDPK1 with 14-3-3 protein (By similarity) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

KLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTV

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

38 kDa

Protein Length

350

NCBI Gene Symbol

STRAP

Host or Source

Rabbit

Protein Name

Serine-threonine kinase receptor-associated protein

Gene Name URL

STRAP

Nucleotide Accession Number

NM_011499.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4921501E09Rik CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
10569154 3x 1.0 µg DNA

4921501E09Rik CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
PITX3 Rabbit pAb
E45R18183N-100 100 µL

PITX3 Rabbit pAb

Sign In for Pricing
View Details
2- ((5-Chloro-2- ((4- (Piperazin-1-Yl) Phenyl) Amino) Pyrimidin-4-Yl) Amino) -N-Methylbenzamide
OR1023234-01 100 mg

2- ((5-Chloro-2- ((4- (Piperazin-1-Yl) Phenyl) Amino) Pyrimidin-4-Yl) Amino) -N-Methylbenzamide

Sign In for Pricing
View Details
2- ((5-Chloro-2- ((4- (Piperazin-1-Yl) Phenyl) Amino) Pyrimidin-4-Yl) Amino) -N-Methylbenzamide
OR1023234-02 250 mg

2- ((5-Chloro-2- ((4- (Piperazin-1-Yl) Phenyl) Amino) Pyrimidin-4-Yl) Amino) -N-Methylbenzamide

Sign In for Pricing
View Details
Tracazolate hydrochloride
B6790-10 10 mg

Tracazolate hydrochloride

Sign In for Pricing
View Details
Mouse Monoclonal DAP10/HCST Antibody (982101) [DyLight 650]
MAB97861C 0.1 mL

Mouse Monoclonal DAP10/HCST Antibody (982101) [DyLight 650]

Sign In for Pricing
View Details