Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EZH2 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Enhancer of zeste 2 polycomb repressive complex 2 subunit

Gene Aliases

Enx-, Enx1, KMT6, Enx-1, Enx1h, mKIAA4065

Gene ID

14056

Swiss Prot

Q61188

Accession Number

NP_031997.2

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse EZH2

Target

Polycomb group (PcG) protein. Catalytic subunit of the PRC2/EED-EZH2 complex, which methylates (H3K9me) and 'Lys-27' (H3K27me) of histone H3, leading to transcriptional repression of the affected target gene. Able to mono-, di- and trimethylate 'Lys-27' of histone H3 to form H3K27me1, H3K27me2 and H3K27me3, respectively. Displays a preference for substrates with less methylation, loses activity when progressively more methyl groups are incorporated into H3K27, H3K27me0 > H3K27me1 > H3K27me2. Compared to EZH1-containing complexes, it is more abundant in embryonic stem cells and plays a major role in forming H3K27me3, which is required for embryonic stem cell identity and proper differentiation. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXA7, HOXB6 and HOXC8. EZH2 can also methylate non-histone proteins such as the transcription factor GATA4 and the nuclear receptor RORA. Regulates the circadian clock via histone methylation at the promoter of the circadian genes. Essential for the CRY1/2-mediated repression of the transcriptional activation of PER1/2 by the CLOCK-ARNTL/BMAL1 heterodimer; involved in the di and trimethylation of 'Lys-27' of histone H3 on PER1/2 promoters which is necessary for the CRY1/2 proteins to inhibit transcription.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

INDEIFVELVNALGQYNDDDDDDDGDDPDEREEKQKDLEDNRDDKETCPP

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

82 kDa

Protein Length

746

NCBI Gene Symbol

EZH2

Host or Source

Rabbit

Protein Name

Histone-lysine N-methyltransferase EZH2

Gene Name URL

EZH2

Nucleotide Accession Number

NM_007971.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOL7 CytoSection
TS409354P5 25 Slides

NOL7 CytoSection

Sign In for Pricing
View Details
MMP12 Polyclonal Antibody
MBS2520716-01 0.02 mL

MMP12 Polyclonal Antibody

Sign In for Pricing
View Details
MMP12 Polyclonal Antibody
MBS2520716-02 0.06 mL

MMP12 Polyclonal Antibody

Sign In for Pricing
View Details
MMP12 Polyclonal Antibody
MBS2520716-03 0.12 mL

MMP12 Polyclonal Antibody

Sign In for Pricing
View Details
MMP12 Polyclonal Antibody
MBS2520716-04 0.2 mL

MMP12 Polyclonal Antibody

Sign In for Pricing
View Details
MMP12 Polyclonal Antibody
MBS2520716-05 5x 0.2 mL

MMP12 Polyclonal Antibody

Sign In for Pricing
View Details