What is the catalog number for USP25 Antibody (ARP88404_P050)?

The catalog number for USP25 Antibody (ARP88404_P050) is ARP88404_P050.

What sizes are available for USP25 Antibody (ARP88404_P050)?

USP25 Antibody (ARP88404_P050) is available in the following size(s): 100 µL.

Is USP25 Antibody (ARP88404_P050) in stock?

USP25 Antibody (ARP88404_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

USP25 Antibody (ARP88404_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Ubiquitin specific peptidase 25

Gene Aliases

USP21

Gene ID

29761

Swiss Prot

Q9UHP3-3

Accession Number

NP_001269970.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human USP25

Target

Ubiquitin is a highly conserved 76-amino acid protein involved in regulation of intracellular protein breakdown, cell cycle regulation, and stress response. Ubiquitin is released from degraded proteins by disassembly of the polyubiquitin chains, which is mediated by ubiquitin-specific proteases (USPs), such as USP25.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

AISRVLEASIAENKACLKRTPTEVWRDSRNPYDRKRQDKAPVGLKNVGNT

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol