What is the catalog number for CRABP2 Antibody (ARP88221_P050)?

The catalog number for CRABP2 Antibody (ARP88221_P050) is ARP88221_P050.

What sizes are available for CRABP2 Antibody (ARP88221_P050)?

CRABP2 Antibody (ARP88221_P050) is available in the following size(s): 100 µL.

Is CRABP2 Antibody (ARP88221_P050) in stock?

CRABP2 Antibody (ARP88221_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

CRABP2 Antibody (ARP88221_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Cellular retinoic acid binding protein 2

Gene Aliases

RBP6, CRABP-II

Gene ID

1382

Swiss Prot

P29373

Accession Number

NP_001186652.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CRABP2

Target

This gene encodes a member of the retinoic acid (RA, a form of vitamin A) binding protein family and lipocalin/cytosolic fatty-acid binding protein family. The protein is a cytosol-to-nuclear shuttling protein, which facilitates RA binding to its cognate receptor complex and transfer to the nucleus. It is involved in the retinoid signaling pathway, and is associated with increased circulating low-density lipoprotein cholesterol. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTR

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol