Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPA2 Antibody (ARP88155_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Replication protein A2

Gene Aliases

REPA2, RPA32, RP-A p32, RP-A p34

Gene ID

6118

Swiss Prot

P15927-2

Accession Number

NP_001273005.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RPA2

Target

As part of the heterotrimeric replication protein A complex (RPA/RP-A), binds and stabilizes single-stranded DNA intermediates, that form during DNA replication or upon DNA stress. It prevents their reannealing and in parallel, recruits and activates different proteins and complexes involved in DNA metabolism. Thereby, it plays an essential role both in DNA replication and the cellular response to DNA damage. In the cellular response to DNA damage, the RPA complex controls DNA repair and DNA damage checkpoint activation. Through recruitment of ATRIP activates the ATR kinase a master regulator of the DNA damage response. It is required for the recruitment of the DNA double-strand break repair factors RAD51 and RAD52 to chromatin in response to DNA damage. Also recruits to sites of DNA damage proteins like XPA and XPG that are involved in nucleotide excision repair and is required for this mechanism of DNA repair. Plays also a role in base excision repair (BER) probably through interaction with UNG. Also recruits SMARCAL1/HARP, which is involved in replication fork restart, to sites of DNA damage. May also play a role in telomere maintenance.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCT

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

30 kDa

Protein Length

278

NCBI Gene Symbol

RPA2

Host or Source

Rabbit

Protein Name

Replication protein A 32 kDa subunit

Gene Name URL

RPA2

Nucleotide Accession Number

NM_001286076.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TMED5 shRNA (UAS) - Lentiviral human TMED5 shRNA (UAS, RFP) plasmid
GTR15084649 1 Vial

Lentiviral human TMED5 shRNA (UAS) - Lentiviral human TMED5 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Bacteria Protease Inhibitor Cocktail (without EDTA), 100x Strength
BS380 1ml

Bacteria Protease Inhibitor Cocktail (without EDTA), 100x Strength

Sign In for Pricing
View Details
CHO Monoclonal Mesothelin Antibody (anetumab) - Humanized - (Dry Ice)
NBP3-28070-1mg 1 mg

CHO Monoclonal Mesothelin Antibody (anetumab) - Humanized - (Dry Ice)

Sign In for Pricing
View Details
Enzomenib (DSP-5336) 10mg
A24436-10 10 mg

Enzomenib (DSP-5336) 10mg

Sign In for Pricing
View Details
FRA2 (FOSL2) Mouse Monoclonal Antibody [Clone ID: OTI2B4]
TA809660S 30 µL

FRA2 (FOSL2) Mouse Monoclonal Antibody [Clone ID: OTI2B4]

Sign In for Pricing
View Details
MAF1 Recombinant Protein (Mouse)
RP148928 100 µg

MAF1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details