Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAP1 Antibody - C-terminal region (ARP87528_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

BRCA1 associated protein 1

Gene Aliases

UCHL2, hucep-6, HUCEP-13

Gene ID

8314

Swiss Prot

Q92560

Accession Number

NP_004647.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human BAP1

Target

This gene belongs to the ubiquitin C-terminal hydrolase subfamily of deubiquitinating enzymes that are involved in the removal of ubiquitin from proteins. The encoded enzyme binds to the breast cancer type 1 susceptibility protein (BRCA1) via the RING finger domain of the latter and acts as a tumor suppressor. In addition, the enzyme may be involved in regulation of transcription, regulation of cell cycle and growth, response to DNA damage and chromatin dynamics. Germline mutations in this gene may be associated with tumor predisposition syndrome (TPDS), which involves increased risk of cancers including malignant mesothelioma, uveal melanoma and cutaneous melanoma.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

TFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKA

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

80 kDa

Protein Length

729

NCBI Gene Symbol

BAP1

Host or Source

Rabbit

Protein Name

Ubiquitin carboxyl-terminal hydrolase BAP1

Gene Name URL

BAP1

Nucleotide Accession Number

NM_004656.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psmb1 (NM_011185) Mouse Tagged ORF Clone Lentiviral Particle
MR202961L3V 200 µL

Psmb1 (NM_011185) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ARMCX3 Rabbit Polyclonal Antibody
E53P08410 100 µL

ARMCX3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Cynomolgus Monkey THAP5 Protein, His (Fc)-Avi-tagged
THAP5-761C 50 µg

Recombinant Cynomolgus Monkey THAP5 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
NUP98/NSD1 gene fusion probe reagent
FP-424 K Fast probe 100 μL (10-20T), DAPI Staining solution (20T)

NUP98/NSD1 gene fusion probe reagent

Sign In for Pricing
View Details
Rabbit Polyclonal Shugoshin Antibody
NBP2-55825-25ul 25 µL

Rabbit Polyclonal Shugoshin Antibody

Sign In for Pricing
View Details
RAPGEF2 (Rap Guanine Nucleotide Exchange Factor 2, Cyclic Nucleotide ras GEF, CNrasGEF, Neural RAP Guanine Nucleotide Exchange Protein, nRap GEP, PDZ Domain-Containing Guanine Nucleotide Exchange Factor 1, PDZ-GEF1, RA-GEF-1, Ras/Rap1-Associating GEF-1, RAPGEF2, KIAA0313, NRAPGEP, PDZGEF1) (MaxLight 650) discontinued
302695-ML650 100 µL

RAPGEF2 (Rap Guanine Nucleotide Exchange Factor 2, Cyclic Nucleotide ras GEF, CNrasGEF, Neural RAP Guanine Nucleotide Exchange Protein, nRap GEP, PDZ Domain-Containing Guanine Nucleotide Exchange Factor 1, PDZ-GEF1, RA-GEF-1, Ras/Rap1-Associating GEF-1, RAPGEF2, KIAA0313, NRAPGEP, PDZGEF1) (MaxLight 650) discontinued

Sign In for Pricing
View Details