Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAZ1 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Deleted in azoospermia 1

Gene Aliases

DAZ, SPGY

Gene ID

1617

Swiss Prot

Q86SG3-2

Accession Number

NP_004072.3

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DAZ1

Target

This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF) . Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is important for spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair of genes is part of the P2 palindrome and the second pair is part of the P1 palindrome. Each gene contains a 2.4 kb repeat including a 72-bp exon, called the DAZ repeat; the number of DAZ repeats is variable and there are several variations in the sequence of the DAZ repeat. Each copy of the gene also contains a 10.8 kb region that may be amplified; this region includes five exons that encode an RNA recognition motif (RRM) domain. This gene contains three copies of the 10.8 kb repeat. However, no transcripts containing three copies of the RRM domain have been described; thus the RefSeq for this gene contains only two RRM domains.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQSAAN

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

44 kDa

Protein Length

390

NCBI Gene Symbol

DAZ1

Host or Source

Rabbit

Protein Name

Deleted in azoospermia protein 1

Gene Name URL

DAZ1

Nucleotide Accession Number

NM_004081.5

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEPT6 AAV siRNA Pooled Vector
43402161 1.0 µg

SEPT6 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant Rat Neurotensin receptor type 2 (Ntsr2)
MBS7023679-01 0.02 mg

Recombinant Rat Neurotensin receptor type 2 (Ntsr2)

Sign In for Pricing
View Details
Recombinant Rat Neurotensin receptor type 2 (Ntsr2)
MBS7023679-02 0.1 mg

Recombinant Rat Neurotensin receptor type 2 (Ntsr2)

Sign In for Pricing
View Details
Recombinant Rat Neurotensin receptor type 2 (Ntsr2)
MBS7023679-03 5x 0.1 mg

Recombinant Rat Neurotensin receptor type 2 (Ntsr2)

Sign In for Pricing
View Details
Influenza A virus (H18N11) HA/Hemagglutinin Protein (N-His, Influenza A virus (A/dark fruit-eating bat/Bolivia/PBV780-781/2011 (H18N11) ) )
P505135 100 µg

Influenza A virus (H18N11) HA/Hemagglutinin Protein (N-His, Influenza A virus (A/dark fruit-eating bat/Bolivia/PBV780-781/2011 (H18N11) ) )

Sign In for Pricing
View Details
Zbtb8a Mouse shRNA Plasmid (Locus ID 73680)
TL512718 1 Kit

Zbtb8a Mouse shRNA Plasmid (Locus ID 73680)

Sign In for Pricing
View Details