Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK8 Antibody Middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Mitogen-activated protein kinase 8

Gene Aliases

JNK, JNK1, PRKM8, SAPK1, JNK-46, JNK1A2, SAPK1c, JNK21B1/2

Gene ID

5599

Swiss Prot

P45983

Accession Number

NP_001265476.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MAPK8

Target

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various cell stimuli, and targets specific transcription factors, and thus mediates immediate-early gene expression in response to cell stimuli. The activation of this kinase by tumor-necrosis factor alpha (TNF-alpha) is found to be required for TNF-alpha induced apoptosis. This kinase is also involved in UV radiation induced apoptosis, which is thought to be related to cytochrom c-mediated cell death pathway. Studies of the mouse counterpart of this gene suggested that this kinase play a key role in T cell proliferation, apoptosis and differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

KMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTI

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

46 kDa

Protein Length

427

NCBI Gene Symbol

MAPK8

Host or Source

Rabbit

Protein Name

Mitogen-activated protein kinase 8

Gene Name URL

MAPK8

Nucleotide Accession Number

NM_001278547.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HP-IgA (Helicobcter Pylori-Immunoglobulin A) ELISA Kit
MBS7618305-01 48 Well

Human HP-IgA (Helicobcter Pylori-Immunoglobulin A) ELISA Kit

Sign In for Pricing
View Details
Human HP-IgA (Helicobcter Pylori-Immunoglobulin A) ELISA Kit
MBS7618305-02 96 Well

Human HP-IgA (Helicobcter Pylori-Immunoglobulin A) ELISA Kit

Sign In for Pricing
View Details
Human HP-IgA (Helicobcter Pylori-Immunoglobulin A) ELISA Kit
MBS7618305-03 5x 96 Well

Human HP-IgA (Helicobcter Pylori-Immunoglobulin A) ELISA Kit

Sign In for Pricing
View Details
Human HP-IgA (Helicobcter Pylori-Immunoglobulin A) ELISA Kit
MBS7618305-04 10x 96 Well

Human HP-IgA (Helicobcter Pylori-Immunoglobulin A) ELISA Kit

Sign In for Pricing
View Details
Tissue, Total RNA Matched Pairs, Human Primary Tumor and Normal, Stomach, BioGenomicsTM
T5595-7771 2x 10 µg

Tissue, Total RNA Matched Pairs, Human Primary Tumor and Normal, Stomach, BioGenomicsTM

Sign In for Pricing
View Details
Rabbit Anti-B. burgdorferi OspC Polyclonal antibody
CABT-CS892 100 μg

Rabbit Anti-B. burgdorferi OspC Polyclonal antibody

Sign In for Pricing
View Details