What is the catalog number for PSEN1 Antibody - N-terminal region (ARP87278_P050)?

The catalog number for PSEN1 Antibody - N-terminal region (ARP87278_P050) is ARP87278_P050.

What sizes are available for PSEN1 Antibody - N-terminal region (ARP87278_P050)?

PSEN1 Antibody - N-terminal region (ARP87278_P050) is available in the following size(s): 100 µL.

Is PSEN1 Antibody - N-terminal region (ARP87278_P050) in stock?

PSEN1 Antibody - N-terminal region (ARP87278_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

PSEN1 Antibody - N-terminal region (ARP87278_P050)

Selected Variant

ARP87278_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

Presenilin 1

Gene Aliases

AD3, FAD, PS1, PS-1, S182, ACNINV3

Gene ID

5663

Swiss Prot

P49768

Accession Number

NP_000012.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PSEN1

Target

Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1; PSEN2) or in the amyloid precursor protein (APP) . These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains) . Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor, such that they either directly regulate gamma-secretase activity or themselves are protease enzymes. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene, the full-length nature of only some have been determined.Â

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GNSRQVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFY

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

53 kDa

Protein Length

467

NCBI Gene Symbol

PSEN1

Host or Source

Rabbit

Protein Name

Presenilin-1

Gene Name URL

PSEN1

Nucleotide Accession Number

NM_000021.3

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 19 (KRT19/799 + KRT19/800), CF568 conjugate, 0.1mg/mL

BNC681150-500 1x 500 µL