What is the catalog number for FKBP5 Antibody - N-terminal region?

The catalog number for FKBP5 Antibody - N-terminal region is ARP87215_P050-25UL.

What sizes are available for FKBP5 Antibody - N-terminal region?

FKBP5 Antibody - N-terminal region is available in the following size(s): 25 µL.

Is FKBP5 Antibody - N-terminal region in stock?

FKBP5 Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

FKBP5 Antibody - N-terminal region

Selected Variant

ARP87215_P050-25UL

Size: 25 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

FK506 binding protein 5

Gene Aliases

P54, AIG6, FKBP51, FKBP54, PPIase, Ptg-10

Gene ID

2289

Swiss Prot

Q13451

Accession Number

NP_001139247.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FKBP5

Target

The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites. Alternative splicing results in multiple transcript variants.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEY

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

50 kDa

Protein Length

457

NCBI Gene Symbol

FKBP5

Host or Source

Rabbit

Protein Name

Peptidyl-prolyl cis-trans isomerase FKBP5

Gene Name URL

FKBP5

Nucleotide Accession Number

NM_001145775.2

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

M02145-1 100 µL/Vial