Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-B Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Major histocompatibility complex, class I, B

Gene Aliases

AS, HLAB, B-4901

Gene ID

3106

Swiss Prot

P30480

Accession Number

XP_011545540.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HLA-B

Target

HLA-B belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin) . The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exon 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-B alleles have been described.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

TQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHH

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

39 kDa

Protein Length

362

NCBI Gene Symbol

HLA-B

Host or Source

Rabbit

Protein Name

HLA class I histocompatibility antigen, B-42 alpha chain

Gene Name URL

HLA-B

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IPO4 Protein, N-His
HP026012-01 50 µg

Recombinant Human IPO4 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human IPO4 Protein, N-His
HP026012-02 100 µg

Recombinant Human IPO4 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human IPO4 Protein, N-His
HP026012-03 1 mg

Recombinant Human IPO4 Protein, N-His

Sign In for Pricing
View Details
Malignant T-Cell Amplified Sequence 1 (MCTS1) Peptide
abx616932 100 µg

Malignant T-Cell Amplified Sequence 1 (MCTS1) Peptide

Sign In for Pricing
View Details
IGFN1 (Immunoglobulin-like and Fibronectin Type III Domain-containing Protein 1, EEF1A2-binding Protein 1, KY-interacting Protein 1, EEF1A2BP1, KYIP1, DKFZp434B1231) (MaxLight 405)
MBS6189805-01 0.1 mL

IGFN1 (Immunoglobulin-like and Fibronectin Type III Domain-containing Protein 1, EEF1A2-binding Protein 1, KY-interacting Protein 1, EEF1A2BP1, KYIP1, DKFZp434B1231) (MaxLight 405)

Sign In for Pricing
View Details
IGFN1 (Immunoglobulin-like and Fibronectin Type III Domain-containing Protein 1, EEF1A2-binding Protein 1, KY-interacting Protein 1, EEF1A2BP1, KYIP1, DKFZp434B1231) (MaxLight 405)
MBS6189805-02 5x 0.1 mL

IGFN1 (Immunoglobulin-like and Fibronectin Type III Domain-containing Protein 1, EEF1A2-binding Protein 1, KY-interacting Protein 1, EEF1A2BP1, KYIP1, DKFZp434B1231) (MaxLight 405)

Sign In for Pricing
View Details