What is the catalog number for SIRT2 Antibody - C-terminal region?

The catalog number for SIRT2 Antibody - C-terminal region is ARP87144_P050-25UL.

What sizes are available for SIRT2 Antibody - C-terminal region?

SIRT2 Antibody - C-terminal region is available in the following size(s): 25 µL.

Is SIRT2 Antibody - C-terminal region in stock?

SIRT2 Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

SIRT2 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Sirtuin 2

Gene Aliases

SIR2, SIR2L, SIR2L2

Gene ID

22933

Swiss Prot

Q8IXJ6-3

Accession Number

NP_001180215.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SIRT2

Target

This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Several transcript variants are resulted from alternative splicing of this gene.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GCLALAELLGWKKELEDLVRREHASIDAQSGAGVPNPSTSASPKKSPPPA

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol