What is the catalog number for CTTN Antibody - middle region?

The catalog number for CTTN Antibody - middle region is ARP87101_P050-25UL.

What sizes are available for CTTN Antibody - middle region?

CTTN Antibody - middle region is available in the following size(s): 25 µL.

Is CTTN Antibody - middle region in stock?

CTTN Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

CTTN Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Cortactin

Gene Aliases

EMS1

Gene ID

2017

Swiss Prot

Q14247-2

Accession Number

NP_001171669.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CTTN

Target

This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Three splice variants that encode different isoforms have been identified for this gene.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

YSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDK

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol