What is the catalog number for XRCC5 Antibody - middle region (ARP87060_P050)?

The catalog number for XRCC5 Antibody - middle region (ARP87060_P050) is ARP87060_P050.

What sizes are available for XRCC5 Antibody - middle region (ARP87060_P050)?

XRCC5 Antibody - middle region (ARP87060_P050) is available in the following size(s): 100 µL.

Is XRCC5 Antibody - middle region (ARP87060_P050) in stock?

XRCC5 Antibody - middle region (ARP87060_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

XRCC5 Antibody - middle region (ARP87060_P050)

Selected Variant

ARP87060_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

X-ray repair cross complementing 5

Gene Aliases

KU80, KUB2, Ku86, NFIV, KARP1, KARP-1

Gene ID

7520

Swiss Prot

P13010

Accession Number

NP_066964.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human XRCC5

Target

The protein encoded by this gene is the 80-kilodalton subunit of the Ku heterodimer protein which is also known as ATP-dependant DNA helicase II or DNA repair protein XRCC5. Ku is the DNA-binding component of the DNA-dependent protein kinase, and it functions together with the DNA ligase IV-XRCC4 complex in the repair of DNA double-strand break by non-homologous end joining and the completion of V (D) J recombination events. This gene functionally complements Chinese hamster xrs-6, a mutant defective in DNA double-strand break repair and in ability to undergo V (D) J recombination. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

QFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMV

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

80 kDa

Protein Length

732

NCBI Gene Symbol

XRCC5

Host or Source

Rabbit

Protein Name

X-ray repair cross-complementing protein 5

Gene Name URL

XRCC5

Nucleotide Accession Number

NM_021141.3

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM7 (Proliferation Marker) (MCM7/2756R), CF405S conjugate, 0.1mg/mL

BNC042756-500 1x 500 µL