What is the catalog number for GNA12 Antibody - middle region (ARP86929_P050)?

The catalog number for GNA12 Antibody - middle region (ARP86929_P050) is ARP86929_P050.

What sizes are available for GNA12 Antibody - middle region (ARP86929_P050)?

GNA12 Antibody - middle region (ARP86929_P050) is available in the following size(s): 100 µL.

Is GNA12 Antibody - middle region (ARP86929_P050) in stock?

GNA12 Antibody - middle region (ARP86929_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

GNA12 Antibody - middle region (ARP86929_P050)

Selected Variant

ARP86929_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

G protein subunit alpha 12

Gene Aliases

RMP, gep, NNX3

Gene ID

2768

Swiss Prot

Q03113

Accession Number

NP_001269370.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GNA12

Target

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Activates effector molecule RhoA by binding and activating RhoGEFs (ARHGEF12/LARG. GNA12-dependent Rho signaling subsequently regulates transcription factor AP-1 (activating protein-1) (By similarity) . GNA12-dependent Rho signaling also regulates protein phosphatese 2A activation causing dephosphorylation of its target proteins. Promotes tumor cell invasion and metastasis by activating RhoA/ROCK signaling pathway and up-regulating proinflammatory cytokine production. Inhibits CDH1-mediated cell adhesion in process independent from Rho activation. Together with NAPA promotes CDH5 localization to plasma membrane. May play a role in the control of cell migration through the TOR signaling cascade.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

IILFLNKMDLLVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRR

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

41 kDa

Protein Length

381

NCBI Gene Symbol

GNA12

Host or Source

Rabbit

Protein Name

Guanine nucleotide-binding protein subunit alpha-12

Gene Name URL

GNA12

Nucleotide Accession Number

NM_001282441.1

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 Tumor Suppressor Protein (DO-1), CF405S conjugate, 0.1mg/mL

BNC041658-100 1x 100 µL