What is the catalog number for ESR1 Antibody - middle region?

The catalog number for ESR1 Antibody - middle region is ARP86741_P050-25UL.

What sizes are available for ESR1 Antibody - middle region?

ESR1 Antibody - middle region is available in the following size(s): 25 µL.

Is ESR1 Antibody - middle region in stock?

ESR1 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

ESR1 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Estrogen receptor 1

Gene Aliases

ER, ESR, Era, ESRA, ESTRR, NR3A1

Gene ID

2099

Swiss Prot

P03372

Accession Number

NP_000116.2

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ESR1

Target

This gene encodes an estrogen receptor, a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative promoter usage and alternative splicing result in dozens of transcript variants, but the full-length nature of many of these variants has not been determined.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

PQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRER

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol