Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK1 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Mitogen-activated protein kinase 1

Gene Aliases

ERK, p38, p40, p41, ERK2, ERT1, NS13, ERK-2, MAPK2, PRKM1, PRKM2, P42MAPK, p41mapk, p42-MAPK

Gene ID

5594

Swiss Prot

P28482-2

Accession Number

NP_002736.3

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of Human MAPK1

Target

This gene encodes a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. One study also suggests that this protein acts as a transcriptional repressor independent of its kinase activity. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDL

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

36 kDa

Protein Length

316

NCBI Gene Symbol

MAPK1

Host or Source

Rabbit

Protein Name

Mitogen-activated protein kinase 1

Gene Name URL

MAPK1

Nucleotide Accession Number

NM_002745.4

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMO (Smoothened Homolog (Drosophila), Gx, SMOH) (MaxLight 405) discontinued
251879-ML405 100 µL

SMO (Smoothened Homolog (Drosophila), Gx, SMOH) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal A20/TNFAIP3 Antibody
NBP2-20671 0.1 mL

Rabbit Polyclonal A20/TNFAIP3 Antibody

Sign In for Pricing
View Details
Mouse ADRA1A shRNA Plasmid
abx969061-01 150 µg

Mouse ADRA1A shRNA Plasmid

Sign In for Pricing
View Details
Mouse ADRA1A shRNA Plasmid
abx969061-02 300 µg

Mouse ADRA1A shRNA Plasmid

Sign In for Pricing
View Details
Elk4 (NM_007923) Mouse Tagged Lenti ORF Clone
MR225575L4 10 µg

Elk4 (NM_007923) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
STK35 siRNA (Human)
MBS8234854-01 15 nmol

STK35 siRNA (Human)

Sign In for Pricing
View Details