Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL22 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Mitochondrial ribosomal protein L22

Gene Aliases

L22mt, RPML25, HSPC158, MRP-L22, MRP-L25

Gene ID

29093

Swiss Prot

Q9NWU5

Accession Number

NP_001014990.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle terminal region of human MRPL22

Target

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the L22 ribosomal protein family. A pseudogene corresponding to this gene is found on chromosome 4q. Two transcript variants encoding different isoforms have been found for this gene.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ALWIHNLRSRGKLALGVLPQSYIHTSASLDISRKWEKKNKIVYPPQLPGE

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

22 kDa

Protein Length

206

NCBI Gene Symbol

MRPL22

Host or Source

Rabbit

Protein Name

39S ribosomal protein L22, mitochondrial

Gene Name URL

MRPL22

Nucleotide Accession Number

NM_001014990.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR9 (Toll-like Receptor 9, CD289) (MaxLight 405) discontinued
252775-ML405 100 µL

TLR9 (Toll-like Receptor 9, CD289) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Human Coronavirus NL63 Nucleoprotein, His-Tag (E. coli)
REC31858-100 1 Each

Human Coronavirus NL63 Nucleoprotein, His-Tag (E. coli)

Sign In for Pricing
View Details
Rabbit anti Dog IgG
40C-CB0415 5mg

Rabbit anti Dog IgG

Sign In for Pricing
View Details
Porcine DAG1 (Dystrophin Associated Glycoprotein 1) ELISA Kit
MBS2508694-01 24 Tests

Porcine DAG1 (Dystrophin Associated Glycoprotein 1) ELISA Kit

Sign In for Pricing
View Details
Porcine DAG1 (Dystrophin Associated Glycoprotein 1) ELISA Kit
MBS2508694-02 48 Tests

Porcine DAG1 (Dystrophin Associated Glycoprotein 1) ELISA Kit

Sign In for Pricing
View Details
Porcine DAG1 (Dystrophin Associated Glycoprotein 1) ELISA Kit
MBS2508694-03 96 Tests

Porcine DAG1 (Dystrophin Associated Glycoprotein 1) ELISA Kit

Sign In for Pricing
View Details