What is the catalog number for SLC35C2 Antibody - C-terminal region?

The catalog number for SLC35C2 Antibody - C-terminal region is ARP86472_P050-25UL.

What sizes are available for SLC35C2 Antibody - C-terminal region?

SLC35C2 Antibody - C-terminal region is available in the following size(s): 25 µL.

Is SLC35C2 Antibody - C-terminal region in stock?

SLC35C2 Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

SLC35C2 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Solute carrier family 35 (GDP-fucose transporter), member C2

Gene Aliases

CGI-15, OVCOV1, C20orf5, BA394O2.1

Gene ID

51006

Swiss Prot

Q9NQQ7-3

Accession Number

NP_001268386.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SLC35C2

Target

This gene encodes a member of the triose-phosphate transporter protein family. This gene is regulated by oxygen tension, is induced in hypoxic trophoblast cells, and is overexpressed in ovarian cancer. Alternative splicing results in multiple transcript variants. A pseudogene of this gene has been defined on the X chromosome.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

HLLGDQISLLNWLGFALCLSGISLHVALKALHSRGDGGPKALKGLGSSPD

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol