What is the catalog number for KATNA1 Antibody - middle region?

The catalog number for KATNA1 Antibody - middle region is ARP86449_P050-25UL.

What sizes are available for KATNA1 Antibody - middle region?

KATNA1 Antibody - middle region is available in the following size(s): 25 µL.

Is KATNA1 Antibody - middle region in stock?

KATNA1 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

KATNA1 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Katanin p60 (ATPase containing) subunit A 1

Gene ID

11104

Swiss Prot

O75449

Accession Number

NP_001191005.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle terminal region of human KATNA1

Target

Microtubules, polymers of alpha and beta tubulin subunits, form the mitotic spindle of a dividing cell and help to organize membranous organelles during interphase. Katanin is a heterodimer that consists of a 60 kDa ATPase (p60 subunit A 1) and an 80 kDa accessory protein (p80 subunit B 1) . The p60 subunit acts to sever and disassemble microtubules, while the p80 subunit targets the enzyme to the centrosome. This gene encodes the p80 subunit. This protein is a member of the AAA family of ATPases. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DRGKAVRCREKKEQNKGREEKNKSPAAVTEPETNKFDSTGYDKDLVEALE

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol