What is the catalog number for MRPL48 Antibody - C-terminal region (ARP86301_P050)?

The catalog number for MRPL48 Antibody - C-terminal region (ARP86301_P050) is ARP86301_P050.

What sizes are available for MRPL48 Antibody - C-terminal region (ARP86301_P050)?

MRPL48 Antibody - C-terminal region (ARP86301_P050) is available in the following size(s): 100 µL.

Is MRPL48 Antibody - C-terminal region (ARP86301_P050) in stock?

MRPL48 Antibody - C-terminal region (ARP86301_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

MRPL48 Antibody - C-terminal region (ARP86301_P050)

Selected Variant

ARP86301_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

Mitochondrial ribosomal protein L48

Gene Aliases

L48MT, CGI-118, HSPC290, MRP-L48

Gene ID

51642

Swiss Prot

Q96GC5

Accession Number

NP_057139.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MRPL48

Target

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 6p. Several transcript variants, some protein-coding and some non-protein coding, have been found for this gene.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VQISGLSATFAEIFLEIIQSSLPEGVRLSVKEHTEEDFKGRFKARPELEE

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

23 kDa

Protein Length

212

NCBI Gene Symbol

MRPL48

Host or Source

Rabbit

Protein Name

39S ribosomal protein L48, mitochondrial

Gene Name URL

MRPL48

Nucleotide Accession Number

NM_016055.5

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ATP5F1B Antibody Picoband®, Dylight550 Conjugate

A32270-3-Dylight550 100 µg