What is the catalog number for COPS8 Antibody - C-terminal region (ARP86196_P050)?

The catalog number for COPS8 Antibody - C-terminal region (ARP86196_P050) is ARP86196_P050.

What sizes are available for COPS8 Antibody - C-terminal region (ARP86196_P050)?

COPS8 Antibody - C-terminal region (ARP86196_P050) is available in the following size(s): 100 µL.

Is COPS8 Antibody - C-terminal region (ARP86196_P050) in stock?

COPS8 Antibody - C-terminal region (ARP86196_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

COPS8 Antibody - C-terminal region (ARP86196_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

COP9 signalosome subunit 8

Gene Aliases

COP9, CSN8, SGN8

Gene ID

10920

Swiss Prot

Q99627

Accession Number

NP_006701.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human COPS8

Target

The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

TTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFL

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol