What is the catalog number for CPNE3 Antibody - middle region?

The catalog number for CPNE3 Antibody - middle region is ARP85986_P050-25UL.

What sizes are available for CPNE3 Antibody - middle region?

CPNE3 Antibody - middle region is available in the following size(s): 25 µL.

Is CPNE3 Antibody - middle region in stock?

CPNE3 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

CPNE3 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Copine 3

Gene Aliases

CPN3, PRO1071

Gene ID

8895

Swiss Prot

O75131

Accession Number

NP_003900.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CPNE3

Target

Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a protein which contains two type II C2 domains in the amino-terminus and an A domain-like sequence in the carboxy-terminus. The A domain mediates interactions between integrins and extracellular ligands.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DGSHDLIGTFQTTMTKLKEASRSSPVEFECINEKKRQKKKSYKNSGVISV

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol