What is the catalog number for GNA13 Antibody - middle region?

The catalog number for GNA13 Antibody - middle region is ARP85255_P050-25UL.

What sizes are available for GNA13 Antibody - middle region?

GNA13 Antibody - middle region is available in the following size(s): 25 µL.

Is GNA13 Antibody - middle region in stock?

GNA13 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

GNA13 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Guanine nucleotide binding protein (G protein), alpha 13

Gene Aliases

G13

Gene ID

10672

Swiss Prot

Q14344-2

Accession Number

NP_001269354.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GNA13

Target

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Activates effector molecule RhoA by binding and activating RhoGEFs (ARHGEF1/p115RhoGEF, ARHGEF11/PDZ-RhoGEF and ARHGEF12/LARG) . GNA13-dependent Rho signaling subsequently regulates transcription factor AP-1 (activating protein-1) (By similarity) . Promotes tumor cell invasion and metastasis by activating RhoA/ROCK signaling pathway. Inhibits CDH1-mediated cell adhesion in process independent from Rho activation.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

APMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFL

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol