What is the catalog number for CEACAM3 Antibody - middle region (ARP84954_P050)?

The catalog number for CEACAM3 Antibody - middle region (ARP84954_P050) is ARP84954_P050.

What sizes are available for CEACAM3 Antibody - middle region (ARP84954_P050)?

CEACAM3 Antibody - middle region (ARP84954_P050) is available in the following size(s): 100 µL.

Is CEACAM3 Antibody - middle region (ARP84954_P050) in stock?

CEACAM3 Antibody - middle region (ARP84954_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

CEACAM3 Antibody - middle region (ARP84954_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Carcinoembryonic antigen related cell adhesion molecule 3

Gene Aliases

CEA, CGM1, W264, W282, CD66D

Gene ID

1084

Swiss Prot

P40198-2

Accession Number

NP_001264092.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CEACAM3

Target

This gene encodes a member of the family of carcinoembryonic antigen-related cell adhesion molecules (CEACAMs), which are used by several bacterial pathogens to bind and invade host cells. The encoded transmembrane protein directs phagocytosis of several bacterial species that is dependent on the small GTPase Rac. It is thought to serve an important role in controlling human-specific pathogens by the innate immune system. Alternatively spliced transcript variants have been described.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

PPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLI

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

19 kDa

Protein Length

177

NCBI Gene Symbol

CEACAM3

Host or Source

Rabbit

Protein Name

Carcinoembryonic antigen-related cell adhesion molecule 3

Gene Name URL

CEACAM3

Nucleotide Accession Number

NM_001277163.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BNC680160-500 1x 500 µL