What is the catalog number for COX5B Antibody - middle region (ARP84865_P050)?

The catalog number for COX5B Antibody - middle region (ARP84865_P050) is ARP84865_P050.

What sizes are available for COX5B Antibody - middle region (ARP84865_P050)?

COX5B Antibody - middle region (ARP84865_P050) is available in the following size(s): 100 µL.

Is COX5B Antibody - middle region (ARP84865_P050) in stock?

COX5B Antibody - middle region (ARP84865_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

COX5B Antibody - middle region (ARP84865_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Cytochrome c oxidase subunit Vb

Gene Aliases

COXVB

Gene ID

1329

Swiss Prot

P10606

Accession Number

NP_001853.2

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human COX5B

Target

Cytochrome C oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit Vb of the human mitochondrial respiratory chain enzyme.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

TGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICE

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol