What is the catalog number for USP15 Antibody - middle region?

The catalog number for USP15 Antibody - middle region is ARP84847_P050-25UL.

What sizes are available for USP15 Antibody - middle region?

USP15 Antibody - middle region is available in the following size(s): 25 µL.

Is USP15 Antibody - middle region in stock?

USP15 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

USP15 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Ubiquitin specific peptidase 15

Gene Aliases

UNPH4, UNPH-2

Gene ID

9958

Swiss Prot

Q9Y4E8

Accession Number

NP_001239007.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human USP15

Target

This gene encodes a member of the ubiquitin specific protease (USP) family of deubiquitinating enzymes. USP enzymes play critical roles in ubiquitin-dependent processes through polyubiquitin chain disassembly and hydrolysis of ubiquitin-substrate bonds. The encoded protein associates with the COP9 signalosome, and also plays a role in transforming growth factor beta signalling through deubiquitination of receptor-activated SMAD transcription factors. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 2.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

CLPSYTAYKNYDYSEPGRNNEQPGLCGLSNLGNTCFMNSAIQCLSNTPPL

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol