What is the catalog number for RAB6A Antibody - middle region (ARP84790_P050)?

The catalog number for RAB6A Antibody - middle region (ARP84790_P050) is ARP84790_P050.

What sizes are available for RAB6A Antibody - middle region (ARP84790_P050)?

RAB6A Antibody - middle region (ARP84790_P050) is available in the following size(s): 100 µL.

Is RAB6A Antibody - middle region (ARP84790_P050) in stock?

RAB6A Antibody - middle region (ARP84790_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

RAB6A Antibody - middle region (ARP84790_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

RAB6A, member RAS oncogene family

Gene Aliases

RAB6

Gene ID

5870

Swiss Prot

P20340

Accession Number

NP_001230647.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle terminal region of Human RAB6A

Target

This gene encodes a member of the RAB family, which belongs to the small GTPase superfamily. GTPases of the RAB family bind to various effectors to regulate the targeting and fusion of transport carriers to acceptor compartments. This protein is located at the Golgi apparatus, which regulates trafficking in both a retrograde (from early endosomes and Golgi to the endoplasmic reticulum) and an anterograde (from the Golgi to the plasma membrane) directions. Myosin II is an effector of this protein in these processes. This protein is also involved in assembly of human cytomegalovirus (HCMV) by interacting with the cellular protein Bicaudal D1, which interacts with the HCMV virion tegument protein, pp150. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQ

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

24 kDa

Protein Length

208

NCBI Gene Symbol

RAB6A

Host or Source

Rabbit

Protein Name

Ras-related protein Rab-6A

Gene Name URL

RAB6A

Nucleotide Accession Number

NM_001243718.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BNC400345-500 1x 500 µL