Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARF3 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

ADP ribosylation factor 3

Gene ID

377

Swiss Prot

P84077

Accession Number

NP_001650.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ARF3

Target

ADP-ribosylation factor 3 (ARF3) is a member of the human ARF gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2, and ARF3), class II (ARF4 and ARF5) and class III (ARF6) and members of each class share a common gene organization. The ARF3 gene contains five exons and four introns.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

PLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFA

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

19 kDa

Protein Length

181

NCBI Gene Symbol

ARF3

Host or Source

Rabbit

Protein Name

ADP-ribosylation factor 3

Gene Name URL

ARF3

Nucleotide Accession Number

NM_001659.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human SIGLEC15/CD33L3 Antibody (A9E8)
MBS1564568-01 0.05 mg

Anti-Human SIGLEC15/CD33L3 Antibody (A9E8)

Sign In for Pricing
View Details
Anti-Human SIGLEC15/CD33L3 Antibody (A9E8)
MBS1564568-02 0.1 mg

Anti-Human SIGLEC15/CD33L3 Antibody (A9E8)

Sign In for Pricing
View Details
Anti-Human SIGLEC15/CD33L3 Antibody (A9E8)
MBS1564568-03 5x 0.1 mg

Anti-Human SIGLEC15/CD33L3 Antibody (A9E8)

Sign In for Pricing
View Details
EIF3C, ID (EIF3C, EIF3S8, Eukaryotic translation initiation factor 3 subunit C, Eukaryotic translation initiation factor 3 subunit 8, eIF3 p110) (MaxLight 490)
MBS6294990-01 0.1 mL

EIF3C, ID (EIF3C, EIF3S8, Eukaryotic translation initiation factor 3 subunit C, Eukaryotic translation initiation factor 3 subunit 8, eIF3 p110) (MaxLight 490)

Sign In for Pricing
View Details
EIF3C, ID (EIF3C, EIF3S8, Eukaryotic translation initiation factor 3 subunit C, Eukaryotic translation initiation factor 3 subunit 8, eIF3 p110) (MaxLight 490)
MBS6294990-02 5x 0.1 mL

EIF3C, ID (EIF3C, EIF3S8, Eukaryotic translation initiation factor 3 subunit C, Eukaryotic translation initiation factor 3 subunit 8, eIF3 p110) (MaxLight 490)

Sign In for Pricing
View Details
CD82 (C33 antigen, IA4, Inducible membrane protein R2, Metastasis suppressor Kangai-1, Suppressor of tumorigenicity 6 protein, Tetraspanin-27) (AP) discontinued
144330-AP 100 µL

CD82 (C33 antigen, IA4, Inducible membrane protein R2, Metastasis suppressor Kangai-1, Suppressor of tumorigenicity 6 protein, Tetraspanin-27) (AP) discontinued

Sign In for Pricing
View Details