What is the catalog number for LPAR1 Antibody - C-terminal region?

The catalog number for LPAR1 Antibody - C-terminal region is ARP84602_P050-25UL.

What sizes are available for LPAR1 Antibody - C-terminal region?

LPAR1 Antibody - C-terminal region is available in the following size(s): 25 µL.

Is LPAR1 Antibody - C-terminal region in stock?

LPAR1 Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

LPAR1 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Lysophosphatidic acid receptor 1

Gene Aliases

EDG2, LPA1, VZG1, edg-2, vzg-1, Gpcr26, Mrec1.3, rec.1.3

Gene ID

1902

Swiss Prot

Q92633

Accession Number

NP_001392.2

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human LPAR1

Target

The integral membrane protein encoded by this gene is a lysophosphatidic acid (LPA) receptor from a group known as EDG receptors. These receptors are members of the G protein-coupled receptor superfamily. Utilized by LPA for cell signaling, EDG receptors mediate diverse biologic functions, including proliferation, platelet aggregation, smooth muscle contraction, inhibition of neuroblastoma cell differentiation, chemotaxis, and tumor cell invasion. Two transcript variants encoding the same protein have been identified for this gene

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

NPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGV

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol