Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNA5 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Potassium voltage-gated channel subfamily A member 5

Gene Aliases

HK2, HCK1, PCN1, ATFB7, HPCN1, KV1.5

Gene ID

3741

Swiss Prot

Q16322

Accession Number

NP_002225.2

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KCNA5

Target

Potassium channels represent the most complex class of voltage-gated ino channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog (s) . This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, the function of which could restore the resting membrane potential of beta cells after depolarization and thereby contribute to the regulation of insulin secretion. This gene is intronless, and the gene is clustered with genes KCNA1 and KCNA6 on chromosome 12. Defects in this gene are a cause of familial atrial fibrillation type 7 (ATFB7) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

RLRYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPVNVSLDVFADEIR

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

56 kDa

Protein Length

511

NCBI Gene Symbol

KCNA5

Host or Source

Rabbit

Protein Name

Potassium voltage-gated channel subfamily A member 5

Gene Name URL

KCNA5

Nucleotide Accession Number

NM_002234.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HMGA2 (High Mobility Group AT Hook Protein 2) ELISA Kit
ELK3464-01 48 Tests

Human HMGA2 (High Mobility Group AT Hook Protein 2) ELISA Kit

Sign In for Pricing
View Details
Human HMGA2 (High Mobility Group AT Hook Protein 2) ELISA Kit
ELK3464-02 96 Tests

Human HMGA2 (High Mobility Group AT Hook Protein 2) ELISA Kit

Sign In for Pricing
View Details
Human HMGA2 (High Mobility Group AT Hook Protein 2) ELISA Kit
ELK3464-03 5x 96 Tests

Human HMGA2 (High Mobility Group AT Hook Protein 2) ELISA Kit

Sign In for Pricing
View Details
MAP4K5 Polyclonal Antibody
RD266434A-01 60 μL

MAP4K5 Polyclonal Antibody

Sign In for Pricing
View Details
MAP4K5 Polyclonal Antibody
RD266434A-02 120 μL

MAP4K5 Polyclonal Antibody

Sign In for Pricing
View Details
MAP4K5 Polyclonal Antibody
RD266434A-03 200 µL

MAP4K5 Polyclonal Antibody

Sign In for Pricing
View Details