What is the catalog number for QTRT2 Antibody - middle region?

The catalog number for QTRT2 Antibody - middle region is ARP83301_P050-25UL.

What sizes are available for QTRT2 Antibody - middle region?

QTRT2 Antibody - middle region is available in the following size(s): 25 µL.

Is QTRT2 Antibody - middle region in stock?

QTRT2 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

QTRT2 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Queuine tRNA-ribosyltransferase accessory subunit 2

Gene Aliases

QTRTD1

Gene ID

79691

Swiss Prot

Q9H974

Accession Number

NP_001243764.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human QTRTD1

Target

This gene encodes a subunit of tRNA-guanine transglycosylase. tRNA-guanine transglycosylase is a heterodimeric enzyme complex that plays a critical role in tRNA modification by synthesizing the 7-deazaguanosine queuosine, which is found in tRNAs that code for asparagine, aspartic acid, histidine, and tyrosine. The encoded protein may play a role in the queuosine 5'-monophosphate salvage pathway. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SFDYQPNPEETLLQQNGTQEEIKCMDQIKKIETTGCNQEITSFEINLKEK

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol