What is the catalog number for OSBPL1A Antibody - middle region (ARP83097_P050)?

The catalog number for OSBPL1A Antibody - middle region (ARP83097_P050) is ARP83097_P050.

What sizes are available for OSBPL1A Antibody - middle region (ARP83097_P050)?

OSBPL1A Antibody - middle region (ARP83097_P050) is available in the following size(s): 100 µL.

Is OSBPL1A Antibody - middle region (ARP83097_P050) in stock?

OSBPL1A Antibody - middle region (ARP83097_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

OSBPL1A Antibody - middle region (ARP83097_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

OSBPL1A

Gene Aliases

ORP1, ORP-1, OSBPL1B

Gene ID

114876

Swiss Prot

Q9BXW6-4

Accession Number

NP_001229437.1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human OSBPL1A

Target

This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. Transcript variants derived from alternative promoter usage and/or alternative splicing exist; they encode different isoforms.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LYGKWTECLYSVDPATFDAYKKNDKKNTEEKKNSKQMSTSEELDEMPVPD

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol