Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMED2 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Transmembrane p24 trafficking protein 2

Gene Aliases

P24, P24A, RNP24, p24b1, p24beta1

Gene ID

10959

Swiss Prot

Q15363

Accession Number

NP_006806.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TMED2

Target

Involved in vesicular protein trafficking. Mainly functions in the early secretory pathway but also in post-Golgi membranes. Thought to act as cargo receptor at the lumenal side for incorporation of secretory cargo molecules into transport vesicles and to be involved in vesicle coat formation at the cytoplasmic side. In COPII vesicle-mediated anterograde transport involved in the transport of GPI-anchored proteins and proposed to act together with TMED10 as their cargo receptor; the function specifically implies SEC24C and SEC24D of the COPII vesicle coat and lipid raft-like microdomains of the ER. Recognizes GPI anchors structural remodeled in the ER by PGAP1 and MPPE1. In COPI vesicle-mediated retrograde transport inhibits the GTPase-activating activity of ARFGAP1 towards ARF1 thus preventing immature uncoating and allowing cargo selection to take place. Involved in trafficking of G protein-coupled receptors (GPCRs) . Regulates F2RL1, OPRM1 and P2RY4 exocytic trafficking from the Golgi to the plasma membrane thus contributing to receptor resensitization. Facilitates CASR maturation and stabilization in the early secretory pathway and increases CASR plasma membrane targeting. Proposed to be involved in organization of intracellular membranes such as the maintenance of the Golgi apparatus. May also play a role in the biosynthesis of secreted cargo such as eventual processing.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

FEVAEGGFLDIDVEITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSN

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

22 kDa

Protein Length

201

NCBI Gene Symbol

TMED2

Host or Source

Rabbit

Protein Name

Transmembrane emp24 domain-containing protein 2

Gene Name URL

TMED2

Nucleotide Accession Number

NM_006815.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Ethylpyridinium bis (trifluoromethylsulfonyl) imide
IL-0211-HP-0100 100 g

1-Ethylpyridinium bis (trifluoromethylsulfonyl) imide

Sign In for Pricing
View Details
BSG Knockout huh-7 Polyclonal Cells
ARG28120 1 Million

BSG Knockout huh-7 Polyclonal Cells

Sign In for Pricing
View Details
STAT3 pSer727 Rabbit Polyclonal Antibody
AP01691PU-N 100 µg

STAT3 pSer727 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SARS-CoV-2 (CB6) mAb
MBS8579087-01 0.1 mL

Anti-SARS-CoV-2 (CB6) mAb

Sign In for Pricing
View Details
Anti-SARS-CoV-2 (CB6) mAb
MBS8579087-02 0.1 mL (AF405L)

Anti-SARS-CoV-2 (CB6) mAb

Sign In for Pricing
View Details
Anti-SARS-CoV-2 (CB6) mAb
MBS8579087-03 0.1 mL (AF405S)

Anti-SARS-CoV-2 (CB6) mAb

Sign In for Pricing
View Details