What is the catalog number for TAS2R14 Antibody - C-terminal region?

The catalog number for TAS2R14 Antibody - C-terminal region is ARP82859_P050-25UL.

What sizes are available for TAS2R14 Antibody - C-terminal region?

TAS2R14 Antibody - C-terminal region is available in the following size(s): 25 µL.

Is TAS2R14 Antibody - C-terminal region in stock?

TAS2R14 Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

TAS2R14 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Taste 2 receptor member 14

Gene Aliases

TRB1, T2R14

Gene ID

50840

Swiss Prot

Q9NYV8

Accession Number

NP_076411.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TAS2R14

Target

This gene product belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia. They are organized in the genome in clusters and are genetically linked to loci that influence bitter perception in mice and humans. In functional expression studies, they respond to bitter tastants. This gene maps to the taste receptor gene cluster on chromosome 12p13.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MGMAYPSCHSCVLILGNKKLRQASLSVLLWLRYMFKDGEPSGHKEFRESS

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

34 kDa

Protein Length

317

NCBI Gene Symbol

TAS2R14

Host or Source

Rabbit

Protein Name

Taste receptor type 2 member 14

Gene Name URL

TAS2R14

Nucleotide Accession Number

NM_023922.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL

BNC680218-500 1x 500 µL