What is the catalog number for ARFGAP3 Antibody - middle region (ARP82477_P050)?

The catalog number for ARFGAP3 Antibody - middle region (ARP82477_P050) is ARP82477_P050.

What sizes are available for ARFGAP3 Antibody - middle region (ARP82477_P050)?

ARFGAP3 Antibody - middle region (ARP82477_P050) is available in the following size(s): 100 µL.

Is ARFGAP3 Antibody - middle region (ARP82477_P050) in stock?

ARFGAP3 Antibody - middle region (ARP82477_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

ARFGAP3 Antibody - middle region (ARP82477_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

ADP ribosylation factor GTPase activating protein 3

Gene Aliases

ARFGAP1

Gene ID

26286

Swiss Prot

Q9NP61-2

Accession Number

NP_001135765.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ARFGAP3

Target

The protein encoded by this gene is a GTPase-activating protein (GAP) that associates with the Golgi apparatus and regulates the early secretory pathway of proteins. The encoded protein promotes hydrolysis of ADP-ribosylation factor 1 (ARF1) -bound GTP, which is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles. Dissociation of the coat proteins is a prerequisite for the fusion of these vesicles with target compartments. The activity of this protein is sensitive to phospholipids. Multiple transcript variants encoding different isoforms have been found for this gene. This gene was originally known as ARFGAP1, but that is now the name of a related but different gene.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

TSDMQTIEQESPIMAKPRKKYNDDSDDSYFTSSSSYFDEPVELRSSSFSS

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

51 kDa

Protein Length

472

NCBI Gene Symbol

ARFGAP3

Host or Source

Rabbit

Protein Name

ADP-ribosylation factor GTPase-activating protein 3

Gene Name URL

ARFGAP3

Nucleotide Accession Number

NM_001142293.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL

BNC940679-100 1x 100 µL