What is the catalog number for TMEM97 Antibody - C-terminal region?

The catalog number for TMEM97 Antibody - C-terminal region is ARP82426_P050-25UL.

What sizes are available for TMEM97 Antibody - C-terminal region?

TMEM97 Antibody - C-terminal region is available in the following size(s): 25 µL.

Is TMEM97 Antibody - C-terminal region in stock?

TMEM97 Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

TMEM97 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Transmembrane protein 97

Gene Aliases

MAC30, sigma2R

Gene ID

27346

Swiss Prot

Q5BJF2

Accession Number

NP_055388.2

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TMEM97

Target

TMEM97 is a conserved integral membrane protein that plays a role in controlling cellular cholesterol levels.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol