Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF1E1 Antibody (ARP82340_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Eukaryotic translation elongation factor 1 epsilon 1

Gene Aliases

P18, AIMP3

Gene ID

9521

Swiss Prot

O43324

Accession Number

NP_001129122.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EEF1E1

Target

This gene encodes a multifunctional protein that localizes to both the cytoplasm and nucleus. In the cytoplasm, the encoded protein is an auxiliary component of the macromolecular aminoacyl-tRNA synthase complex. However, its mouse homolog has been shown to translocate to the nucleus in response to DNA damage, and it plays a positive role in ATM/ATR-mediated p53 activation. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream MUTED (muted homolog) gene. An EEF1E1-related pseudogene has been identified on chromosome 2.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

AELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQ

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

20 kDa

Protein Length

174

NCBI Gene Symbol

EEF1E1

Host or Source

Rabbit

Protein Name

Eukaryotic translation elongation factor 1 epsilon-1

Gene Name URL

EEF1E1

Nucleotide Accession Number

NM_001135650.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JNK1, phosphorylated (T183/Y185) (MAPK8, JNK1, PRKM8, SAPK1, SAPK1C, Mitogen-activated protein kinase 8, JNK-46, Stress-activated protein kinase 1c, Stress-activated protein kinase JNK1, c-Jun N-terminal kinase 1) (MaxLight 650) discontinued
037211-ML650 100 µL

JNK1, phosphorylated (T183/Y185) (MAPK8, JNK1, PRKM8, SAPK1, SAPK1C, Mitogen-activated protein kinase 8, JNK-46, Stress-activated protein kinase 1c, Stress-activated protein kinase JNK1, c-Jun N-terminal kinase 1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
CCDC89 (h) -PR
sc-96471-PR 10 µM - 20 µL

CCDC89 (h) -PR

Sign In for Pricing
View Details
DAI/Zbp1 Rabbit Polyclonal Antibody
orb763195 100 µg

DAI/Zbp1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARMC9, NT (ARMC9, KIAA1868, LisH domain-containing protein ARMC9, Melanoma/melanocyte-specific tumor antigen KU-MEL-1, NS21) (APC)
MBS6275260-01 0.2 mL

ARMC9, NT (ARMC9, KIAA1868, LisH domain-containing protein ARMC9, Melanoma/melanocyte-specific tumor antigen KU-MEL-1, NS21) (APC)

Sign In for Pricing
View Details
ARMC9, NT (ARMC9, KIAA1868, LisH domain-containing protein ARMC9, Melanoma/melanocyte-specific tumor antigen KU-MEL-1, NS21) (APC)
MBS6275260-02 5x 0.2 mL

ARMC9, NT (ARMC9, KIAA1868, LisH domain-containing protein ARMC9, Melanoma/melanocyte-specific tumor antigen KU-MEL-1, NS21) (APC)

Sign In for Pricing
View Details
NAT8L ELISA Kit (Human)
OKEH01725-96W 96 Tests

NAT8L ELISA Kit (Human)

Sign In for Pricing
View Details