Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS30 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Mitochondrial ribosomal protein S30

Gene Aliases

PAP, PDCD9, S30mt, MRP-S30

Gene ID

10884

Swiss Prot

Q9NP92

Accession Number

NP_057724.2

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MRPS30

Target

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that is similar to the chicken pro-apoptotic protein p52. Transcript variants using alternative promoters or polyA sites have been mentioned in the literature but the complete description of these sequences is not available.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

FLSGLPPPPAEPEPEPEPEPEPALDLAALRAVACDCLLQEHFYLRRRRRV

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

50 kDa

Protein Length

439

NCBI Gene Symbol

MRPS30

Host or Source

Rabbit

Protein Name

28S ribosomal protein S30, mitochondrial

Gene Name URL

MRPS30

Nucleotide Accession Number

NM_016640.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TCERG1L shRNA (UAS) - Lentiviral human TCERG1L shRNA (UAS, GFP) (25)
GTR15336407 1 Vial

Lentiviral human TCERG1L shRNA (UAS) - Lentiviral human TCERG1L shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Human FBLN3 (Fibulin 3) ELISA Kit
MBS2515643-01 24 Tests (Limit 1)

Human FBLN3 (Fibulin 3) ELISA Kit

Sign In for Pricing
View Details
Human FBLN3 (Fibulin 3) ELISA Kit
MBS2515643-02 48 Tests

Human FBLN3 (Fibulin 3) ELISA Kit

Sign In for Pricing
View Details
Human FBLN3 (Fibulin 3) ELISA Kit
MBS2515643-03 96 Tests

Human FBLN3 (Fibulin 3) ELISA Kit

Sign In for Pricing
View Details
Human FBLN3 (Fibulin 3) ELISA Kit
MBS2515643-04 5x 96 Tests

Human FBLN3 (Fibulin 3) ELISA Kit

Sign In for Pricing
View Details
Human FBLN3 (Fibulin 3) ELISA Kit
MBS2515643-05 10x 96 Tests

Human FBLN3 (Fibulin 3) ELISA Kit

Sign In for Pricing
View Details