What is the catalog number for PTH2R Antibody - C-terminal region?

The catalog number for PTH2R Antibody - C-terminal region is ARP82017_P050-25UL.

What sizes are available for PTH2R Antibody - C-terminal region?

PTH2R Antibody - C-terminal region is available in the following size(s): 25 µL.

Is PTH2R Antibody - C-terminal region in stock?

PTH2R Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

PTH2R Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Parathyroid hormone 2 receptor

Gene Aliases

PTHR2

Gene ID

5746

Swiss Prot

P49190

Accession Number

NP_005039.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PTH2R

Target

The protein encoded by this gene is a member of the G-protein coupled receptor 2 family. This protein is a receptor for parathyroid hormone (PTH) . This receptor is more selective in ligand recognition and has a more specific tissue distribution compared to parathyroid hormone receptor 1 (PTHR1) . It is activated only by PTH and not by parathyroid hormone-like hormone (PTHLH) and is particularly abundant in brain and pancreas. Alternative splicing results in multiple transcript variants.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SNSEQDCLPHSFHEETKEDSGRQGDDILMEKPSRPMESNPDTEGCQGETE

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol