What is the catalog number for KCNA2 Antibody - N-terminal region (ARP81980_P050)?

The catalog number for KCNA2 Antibody - N-terminal region (ARP81980_P050) is ARP81980_P050.

What sizes are available for KCNA2 Antibody - N-terminal region (ARP81980_P050)?

KCNA2 Antibody - N-terminal region (ARP81980_P050) is available in the following size(s): 100 µL.

Is KCNA2 Antibody - N-terminal region (ARP81980_P050) in stock?

KCNA2 Antibody - N-terminal region (ARP81980_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

KCNA2 Antibody - N-terminal region (ARP81980_P050)

Selected Variant

ARP81980_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

Potassium voltage-gated channel subfamily A member 2

Gene Aliases

HK4, MK2, HBK5, NGK1, RBK2, DEE32, HUKIV, KV1.2, EIEE32

Gene ID

3737

Swiss Prot

P16389

Accession Number

NP_001191198.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KCNA2

Target

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog (s) . This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. The coding region of this gene is intronless, and the gene is clustered with genes KCNA3 and KCNA10 on chromosome 1.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VATGDPADEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLA

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

54 kDa

Protein Length

499

NCBI Gene Symbol

KCNA2

Host or Source

Rabbit

Protein Name

Potassium voltage-gated channel subfamily A member 2

Gene Name URL

KCNA2

Nucleotide Accession Number

NM_001204269.1

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1564R), CF647 conjugate, 0.1mg/mL

BNC471564-500 1x 500 µL