What is the catalog number for CACNA2D3 Antibody - middle region (ARP81941_P050)?

The catalog number for CACNA2D3 Antibody - middle region (ARP81941_P050) is ARP81941_P050.

What sizes are available for CACNA2D3 Antibody - middle region (ARP81941_P050)?

CACNA2D3 Antibody - middle region (ARP81941_P050) is available in the following size(s): 100 µL.

Is CACNA2D3 Antibody - middle region (ARP81941_P050) in stock?

CACNA2D3 Antibody - middle region (ARP81941_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

CACNA2D3 Antibody - middle region (ARP81941_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Calcium voltage-gated channel auxiliary subunit alpha2delta 3

Gene Aliases

HSA272268

Gene ID

55799

Swiss Prot

Q8IZS8-3

Accession Number

NP_060868.2

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CACNA2D3

Target

This gene encodes a member of the alpha-2/delta subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of alternative splicing. Research on a highly similar protein in rabbit suggests the protein described in this record is cleaved into alpha-2 and delta subunits. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

THPELRLLYEEGKKRRKPNYSSVDLSEVEWEDRDDVLRNAMVNRKTGKFS

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

57 kDa

Protein Length

519

NCBI Gene Symbol

CACNA2D3

Host or Source

Rabbit

Protein Name

Voltage-dependent calcium channel subunit alpha-2/delta-3

Gene Name URL

CACNA2D3

Nucleotide Accession Number

NM_018398.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL

BNC740391-100 1x 100 µL