What is the catalog number for KCTD12 Antibody - middle region?

The catalog number for KCTD12 Antibody - middle region is ARP81855_P050-25UL.

What sizes are available for KCTD12 Antibody - middle region?

KCTD12 Antibody - middle region is available in the following size(s): 25 µL.

Is KCTD12 Antibody - middle region in stock?

KCTD12 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

KCTD12 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Potassium channel tetramerization domain containing 12

Gene Aliases

PFET1, PFETIN, C13orf2

Gene ID

115207

Swiss Prot

Q96CX2

Accession Number

NP_612453.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KCTD12

Target

Auxiliary subunit of GABA-B receptors that determine the pharmacology and kinetics of the receptor response. Increases agonist potency and markedly alter the G-protein signaling of the receptors by accelerating onset and promoting desensitization.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

AQADAKFRRVARITVCGKTSLAKEVFGDTLNESRDPDRPPERYTSRYYLK

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol