Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAP3 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Death associated protein 3

Gene Aliases

DAP-3, S29mt, MRPS29, MRP-S29, bMRP-10

Gene ID

7818

Swiss Prot

P51398-3

Accession Number

NP_001186778.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DAP3

Target

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that also participates in apoptotic pathways which are initiated by tumor necrosis factor-alpha, Fas ligand, and gamma interferon. This protein potentially binds ATP/GTP and might be a functional partner of the mitoribosomal protein S27. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. Pseudogenes corresponding to this gene are found on chromosomes 1q and 2q.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DQPLEASTWLKNFKTTNERFLNQIKVQEKYVWNKRESTEKGSPLGEVVEQ

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

40 kDa

Protein Length

364

NCBI Gene Symbol

DAP3

Host or Source

Rabbit

Protein Name

28S ribosomal protein S29, mitochondrial

Gene Name URL

DAP3

Nucleotide Accession Number

NM_001199849.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse ZNRD1 shRNA Plasmid
abx975421-01 150 µg

Mouse ZNRD1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse ZNRD1 shRNA Plasmid
abx975421-02 300 µg

Mouse ZNRD1 shRNA Plasmid

Sign In for Pricing
View Details
Recombinant Chicken Homeobox protein SAX-1 (SAX1)
MBS1015055-01 0.02 mg (E-Coli)

Recombinant Chicken Homeobox protein SAX-1 (SAX1)

Sign In for Pricing
View Details
Recombinant Chicken Homeobox protein SAX-1 (SAX1)
MBS1015055-02 0.1 mg (E-Coli)

Recombinant Chicken Homeobox protein SAX-1 (SAX1)

Sign In for Pricing
View Details
Recombinant Chicken Homeobox protein SAX-1 (SAX1)
MBS1015055-03 0.02 mg (Yeast)

Recombinant Chicken Homeobox protein SAX-1 (SAX1)

Sign In for Pricing
View Details
Recombinant Chicken Homeobox protein SAX-1 (SAX1)
MBS1015055-04 0.1 mg (Yeast)

Recombinant Chicken Homeobox protein SAX-1 (SAX1)

Sign In for Pricing
View Details