What is the catalog number for ST6GAL1 Antibody - middle region?

The catalog number for ST6GAL1 Antibody - middle region is ARP81211_P050-25UL.

What sizes are available for ST6GAL1 Antibody - middle region?

ST6GAL1 Antibody - middle region is available in the following size(s): 25 µL.

Is ST6GAL1 Antibody - middle region in stock?

ST6GAL1 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

ST6GAL1 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

ST6 beta-galactosamide alpha-2,6-sialyltranferase 1

Gene Aliases

ST6N, SIAT1, ST6GalI

Gene ID

6480

Swiss Prot

P15907

Accession Number

NP_003023.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ST6GAL1

Target

This gene encodes a member of glycosyltransferase family 29. The encoded protein is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein, which is normally found in the Golgi but can be proteolytically processed to a soluble form, is involved in the generation of the cell-surface carbohydrate determinants and differentiation antigens HB-6, CD75, and CD76. This gene has been incorrectly referred to as CD75. Three transcript variants encoding two different isoforms have been described.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

YHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEI

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol