Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM3 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Minichromosome maintenance complex component 3

Gene Aliases

HCC5, P1.h, RLFB, P1-MCM3

Gene ID

4172

Swiss Prot

P25205

Accession Number

NP_001257401.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MCM3

Target

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with and is acetylated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. Two transcript variants encoding different isoforms have been found for this gene.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ETEDEEEKSQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHT

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

88 kDa

Protein Length

808

NCBI Gene Symbol

MCM3

Host or Source

Rabbit

Protein Name

DNA replication licensing factor MCM3

Gene Name URL

MCM3

Nucleotide Accession Number

NM_001270472.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPX2 Protein Vector (Mouse) (pPB-N-His)
PV186447 500 ng

GPX2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
UPP1 (Uridine Phosphorylase 1, UP, UPASE, UPase 1, UPP, UrdPase 1, UDRPASE) (MaxLight 650)
MBS6225366-01 0.1 mL

UPP1 (Uridine Phosphorylase 1, UP, UPASE, UPase 1, UPP, UrdPase 1, UDRPASE) (MaxLight 650)

Sign In for Pricing
View Details
UPP1 (Uridine Phosphorylase 1, UP, UPASE, UPase 1, UPP, UrdPase 1, UDRPASE) (MaxLight 650)
MBS6225366-02 5x 0.1 mL

UPP1 (Uridine Phosphorylase 1, UP, UPASE, UPase 1, UPP, UrdPase 1, UDRPASE) (MaxLight 650)

Sign In for Pricing
View Details
Mouse Anti-Canine Phosphoenolpyruvate Carboxykinase Mitochondrial (PEPCK) Monoclonal Antibody
VD12N500 1 Each

Mouse Anti-Canine Phosphoenolpyruvate Carboxykinase Mitochondrial (PEPCK) Monoclonal Antibody

Sign In for Pricing
View Details
SAAL1 (NM_138421) Human Over-expression Lysate
LS113174-100ug 100 µg

SAAL1 (NM_138421) Human Over-expression Lysate

Sign In for Pricing
View Details
DLK2, CT (Epidermal Growth Factor-like Protein 9, EGF-like Protein 9, Protein delta Homolog 2, DLK-2, EGFL9, UNQ2903/PRO28633) (MaxLight 550)
MBS6472731-01 0.1 mL

DLK2, CT (Epidermal Growth Factor-like Protein 9, EGF-like Protein 9, Protein delta Homolog 2, DLK-2, EGFL9, UNQ2903/PRO28633) (MaxLight 550)

Sign In for Pricing
View Details