What is the catalog number for MTHFD1 Antibody - middle region (ARP81024_P050)?

The catalog number for MTHFD1 Antibody - middle region (ARP81024_P050) is ARP81024_P050.

What sizes are available for MTHFD1 Antibody - middle region (ARP81024_P050)?

MTHFD1 Antibody - middle region (ARP81024_P050) is available in the following size(s): 100 µL.

Is MTHFD1 Antibody - middle region (ARP81024_P050) in stock?

MTHFD1 Antibody - middle region (ARP81024_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

MTHFD1 Antibody - middle region (ARP81024_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1, methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthetase

Gene Aliases

CIMAH, MTHFC, MTHFD

Gene ID

4522

Swiss Prot

P11586

Accession Number

NP_005947.3

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MTHFD1

Target

This gene encodes a protein that possesses three distinct enzymatic activities, 5,10-methylenetetrahydrofolate dehydrogenase, 5,10-methenyltetrahydrofolate cyclohydrolase and 10-formyltetrahydrofolate synthetase. Each of these activities catalyzes one of three sequential reactions in the interconversion of 1-carbon derivatives of tetrahydrofolate, which are substrates for methionine, thymidylate, and de novo purine syntheses. The trifunctional enzymatic activities are conferred by two major domains, an aminoterminal portion containing the dehydrogenase and cyclohydrolase activities and a larger synthetase domain.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

EWIKPGAIVIDCGINYVPDDKKPNGRKVVGDVAYDEAKERASFITPVPGG

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol