What is the catalog number for SEMA4D Antibody - middle region?

The catalog number for SEMA4D Antibody - middle region is ARP80973_P050-25UL.

What sizes are available for SEMA4D Antibody - middle region?

SEMA4D Antibody - middle region is available in the following size(s): 25 µL.

Is SEMA4D Antibody - middle region in stock?

SEMA4D Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

SEMA4D Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Semaphorin 4D

Gene Aliases

A8, GR3, BB18, CD100, COLL4, SEMAJ, coll-4, C9orf164, M-sema-G

Gene ID

10507

Swiss Prot

Q92854

Accession Number

NP_001135759.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SEMA4D

Target

Cell surface receptor for PLXN1B and PLXNB2 that plays an important role in cell-cell signaling. Promotes reorganization of the actin cytoskeleton and plays a role in axonal growth cone guidance in the developing central nervous system. Regulates dendrite and axon branching and morphogenesis. Promotes the migration of cerebellar granule cells and of endothelial cells. Plays a role in the immune system; induces B-cells to aggregate and improves their viability (in vitro) . Promotes signaling via SRC and PTK2B/PYK2, which then mediates activation of phosphatidylinositol 3-kinase and of the AKT1 signaling cascade. Interaction with PLXNB1 mediates activation of RHOA.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ISRNSSHSPLRTEYAIPWLNEPSFVFADVIRKSPDSPDGEDDRVYFFFTE

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol