What is the catalog number for CCR3 Antibody - C-terminal region (ARP80649_P050)?

The catalog number for CCR3 Antibody - C-terminal region (ARP80649_P050) is ARP80649_P050.

What sizes are available for CCR3 Antibody - C-terminal region (ARP80649_P050)?

CCR3 Antibody - C-terminal region (ARP80649_P050) is available in the following size(s): 100 µL.

Is CCR3 Antibody - C-terminal region (ARP80649_P050) in stock?

CCR3 Antibody - C-terminal region (ARP80649_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

CCR3 Antibody - C-terminal region (ARP80649_P050)

Selected Variant

ARP80649_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

Chemokine (C-C motif) receptor 3

Gene Aliases

CKR3, CD193, CKR 3, CMKBR3, C C CKR3, CC-CKR-3

Gene ID

1232

Swiss Prot

P51677

Accession Number

NP_001828.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CCR3

Target

The protein encoded by this gene is a receptor for C-C type chemokines. It belongs to family 1 of the G protein-coupled receptors. This receptor binds and responds to a variety of chemokines, including eotaxin (CCL11), eotaxin-3 (CCL26), MCP-3 (CCL7), MCP-4 (CCL13), and RANTES (CCL5) . It is highly expressed in eosinophils and basophils, and is also detected in TH1 and TH2 cells, as well as in airway epithelial cells. This receptor may contribute to the accumulation and activation of eosinophils and other inflammatory cells in the allergic airway. It is also known to be an entry co-receptor for HIV-1. This gene and seven other chemokine receptor genes form a chemokine receptor gene cluster on the chromosomal region 3p21. Alternatively spliced transcript variants have been described.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

39 kDa

Protein Length

355

NCBI Gene Symbol

CCR3

Host or Source

Rabbit

Protein Name

C-C chemokine receptor type 3

Gene Name URL

CCR3

Nucleotide Accession Number

NM_001837.3

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syntaxin 4 Recombinant Rabbit Monoclonal Antibody [PSH0-80]

HA721509 100 µL