What is the catalog number for CYP27B1 Antibody - C-terminal region?

The catalog number for CYP27B1 Antibody - C-terminal region is ARP80645_P050-25UL.

What sizes are available for CYP27B1 Antibody - C-terminal region?

CYP27B1 Antibody - C-terminal region is available in the following size(s): 25 µL.

Is CYP27B1 Antibody - C-terminal region in stock?

CYP27B1 Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

CYP27B1 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Cytochrome P450 family 27 subfamily B member 1

Gene Aliases

VDR, CP2B, CYP1, PDDR, VDD1, VDDR, VDDRI, CYP27B, P450c1, CYP1alpha

Gene ID

1594

Swiss Prot

O15528

Accession Number

NP_000776.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CYP27B1

Target

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the inner mitochondrial membrane where it hydroxylates 25-hydroxyvitamin D3 at the 1alpha position. This reaction synthesizes 1alpha,25-dihydroxyvitamin D3, the active form of vitamin D3, which binds to the vitamin D receptor and regulates calcium metabolism. Thus this enzyme regulates the level of biologically active vitamin D and plays an important role in calcium homeostasis. Mutations in this gene can result in vitamin D-dependent rickets type I.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SRDPAQFPEPNSFRPARWLGEGPTPHPFASLPFGFGKRSCMGRRLAELEL

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

55 kDa

Protein Length

508

NCBI Gene Symbol

CYP27B1

Host or Source

Rabbit

Protein Name

25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial

Gene Name URL

CYP27B1

Nucleotide Accession Number

NM_000785.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL

BNC040352-100 1x 100 µL